PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G04590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 177aa    MW: 18991.8 Da    PI: 10.7877
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G04590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.91.8e-1284144262
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      ke  r +r+ +NR++A+  R+RKka++ eLe k+k Le  N +L +++++l++e  +l++ 
  OPUNC01G04590.1  84 KEQNRLKRLLRNRVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQNENNTLRQI 144
                      78899***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-1383147IPR004827Basic-leucine zipper domain
PfamPF001705.7E-1184145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.18585148IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.69E-1288145No hitNo description
Gene3DG3DSA:1.20.5.1709.9E-1788147No hitNo description
CDDcd147041.97E-1488138No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MAAQEQEQEK QQAKTSTTSS LPSSSERSSS SAPNNLKEGG VESDEEIRRG KEDGKQQGGA  60
AAAAAAGQEQ APPARKRGRS AGDKEQNRLK RLLRNRVSAQ QARERKKAYM TELEAKAKDL  120
ELRNAELEQR VSTLQNENNT LRQILKNTTA HAGKRGGGGG GGKGSDGGGK KHHFTKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154162RGGGGGGGK
2160168GGKGSDGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032151e-128AP003215.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0089K24.
GenBankAP0149571e-128AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008655674.15e-67PREDICTED: transcription factor HY5-like
SwissprotQ9SM502e-41HY5_SOLLC; Transcription factor HY5
TrEMBLA0A0E0JEQ01e-122A0A0E0JEQ0_ORYPU; Uncharacterized protein
STRINGGRMZM2G171912_P021e-63(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.19e-33bZIP family protein